PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G07200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 759aa    MW: 82352.6 Da    PI: 6.6141
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G07200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.57e-211671156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     r++ +++t+ q+++Le++F+++++p++++r++L+++lgL+ rq+k+WFqNrR+++k
  OGLUM06G07200.1 16 RKRYHRHTPRQIQQLEAMFKECPHPDENQRAQLSRELGLEPRQIKFWFQNRRTQMK 71
                     688899***********************************************998 PP

2START139.72.9e-442074622206
                      HHHHHHHHHHHHHHHC-TT-EEEE..........EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
            START   2 laeeaaqelvkkalaeepgWvkss..........esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                      +a +a++el+++a+a++  W+ks+          e +n d++ ++f++ ++       ++e +r+sg+v m ++ l   ++d++ +W e ++  
  OGLUM06G07200.1 207 MATRAMDELIRLAQAGDHIWSKSPgggvsggdarETLNVDTYDSIFSKPGGsyrapsINVEGSRESGLVLMSAVALADVFMDTN-KWMEFFPsi 299
                      57899****************************999**********887779****99****************9999999999.********* PP

                      ..EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE.. CS
            START  78 ..kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh.. 161
                        ka t++v+ +g     + l lm+ el  ++p+vp R++ fvRy+rq ++g w+i+dvSvd +++    ++  R+++lpSg+li +++ng+  
  OGLUM06G07200.1 300 vsKAHTIDVLVNGmggrsESLILMYEELHIMTPAVPtREVNFVRYCRQIEQGLWAIADVSVDLQRDAHFGAPPPRSRRLPSGCLIADMANGYsk 393
                      ******************************************************************98899*********************** PP

                      .......................EEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 162 .......................skvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                                              +vtwveh+++++++p   l+r lv sg+a+ga +w+a+lqr ce+
  OGLUM06G07200.1 394 vyamdnvphamvfwfrladdvahARVTWVEHMEVEEKSPiNVLYRDLVLSGAAFGAHRWLAALQRACER 462
                      ***************************************999*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.05E-20976IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-221078IPR009057Homeodomain-like
PROSITE profilePS5007118.2041373IPR001356Homeobox domain
SMARTSM003894.8E-201477IPR001356Homeobox domain
CDDcd000866.39E-201574No hitNo description
PfamPF000462.0E-181671IPR001356Homeobox domain
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PROSITE profilePS5084842.785197465IPR002913START domain
SuperFamilySSF559616.87E-27198464No hitNo description
CDDcd088754.27E-105201461No hitNo description
SMARTSM002344.0E-30206462IPR002913START domain
PfamPF018521.4E-36207462IPR002913START domain
SuperFamilySSF559613.11E-16479680No hitNo description
SuperFamilySSF559613.11E-16708747No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
MDFGDEPEGS DSQRRRKRYH RHTPRQIQQL EAMFKECPHP DENQRAQLSR ELGLEPRQIK  60
FWFQNRRTQM KAQHERADNC FLRAENDKIR CENIAIREAL KNVICPTCGG PPVGEDYFDE  120
QKLRMENARL KEELDRVSNL TSKYLGRPFT QLPPATPPMT VSSLDLSVGG MGGPSLDLDL  180
LSGGSSGIPF QLPAPVSDME RPMMAEMATR AMDELIRLAQ AGDHIWSKSP GGGVSGGDAR  240
ETLNVDTYDS IFSKPGGSYR APSINVEGSR ESGLVLMSAV ALADVFMDTN KWMEFFPSIV  300
SKAHTIDVLV NGMGGRSESL ILMYEELHIM TPAVPTREVN FVRYCRQIEQ GLWAIADVSV  360
DLQRDAHFGA PPPRSRRLPS GCLIADMANG YSKVYAMDNV PHAMVFWFRL ADDVAHARVT  420
WVEHMEVEEK SPINVLYRDL VLSGAAFGAH RWLAALQRAC ERYASLVALG VPHHIAGVTP  480
EGKRSMMKLS QRMVNSFCSS LGASQMHQWT TLSGSNEVSV RVTMHRSTDP GQPNGVVLSA  540
ATSIWLPVPC DHVFAFVRDE NTRSQVSHPL SPPLMSLTHS LCPPLLLLQW DVLSHGNQVQ  600
EVSRIPNGSN PGNCISLLRG LNASQNSMLI LQESCTDASG SLVVYSPIDI PAANVVMSGE  660
DPSSIPLLPS GFTILPDGRP GSAAGASTSS AGPLAAARGG GGGGAGGGSV VTVAFQILVS  720
SLPSSKLNAE SVATVNGLIT TTVEQIKAAL NCSAHGHHP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047580.0AP004758.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0664C05.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642098.10.0PREDICTED: homeobox-leucine zipper protein ROC8
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A0E0A6J80.0A0A0E0A6J8_9ORYZ; Uncharacterized protein
STRINGOB06G16250.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11